Compile Data Set for Download or QSAR
maximum 50k data
Found 2542 of ec50 data for polymerid = 7978
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50547473(CHEMBL4757675)
Affinity DataEC50:  0nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as induction of cAMP accumulation incubated for 30 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataEC50:  0.000400nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataEC50:  0.000400nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataEC50:  0.000501nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells coexpressing beta-arrestin-2 assessed as reduction in cAMP accumulation incubated for 2 hrs u...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50266673(CHEMBL4076828)
Affinity DataEC50:  0.000700nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50152769(CHEMBL410972 | GLP-1(7-36)-NH2 | GLP-17-(7-36) der...)
Affinity DataEC50:  0.000900nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275566(CHEMBL4128276)
Affinity DataEC50:  0.000900nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50547469(CHEMBL4756489)
Affinity DataEC50:  0.00100nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as induction of cAMP accumulation incubated for 30 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoKEGGPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM537097((E)-3-(2-((4-((S)-2-(4-chloro-2-fluorophenyl)-2-me...)
Affinity DataEC50:  0.00100nMAssay Description:To optimize functional activity directed toward Gas coupling, a HEK293/CRE-Luc cell line developed by HDB stably expressing the GLP-1 Receptor was us...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM537035(US11897851, Compound 139a)
Affinity DataEC50:  0.00100nMAssay Description:To optimize functional activity directed toward Gas coupling, a HEK293/CRE-Luc cell line developed by HDB stably expressing the GLP-1 Receptor was us...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50266672(CHEMBL4100420)
Affinity DataEC50:  0.00120nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275596(CHEMBL4129347)
Affinity DataEC50:  0.00140nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50152769(CHEMBL410972 | GLP-1(7-36)-NH2 | GLP-17-(7-36) der...)
Affinity DataEC50:  0.00159nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells coexpressing beta-arrestin-2 assessed as reduction in cAMP accumulation incubated for 2 hrs u...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50571854(CHEMBL4870050)
Affinity DataEC50:  0.00160nMAssay Description:Activation of GLP1R (unknown origin) CRE-bla expressed in CHO-K1 cells assessed as receptor potency incubated for 1 hrs by time resolved fluorescence...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275568(CHEMBL4126738)
Affinity DataEC50:  0.00180nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataEC50:  0.00180nMAssay Description:Agonist activity at recombinant human GLP1 receptor expressed in HEK293 cells assessed as cAMP accumulation by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50266669(CHEMBL4093458)
Affinity DataEC50:  0.00180nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273759(CHEMBL507591)
Affinity DataEC50:  0.00199nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50595614(CHEMBL5173967)
Affinity DataEC50:  0.00199nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells coexpressing beta-arrestin-2 assessed as reduction in cAMP accumulation incubated for 2 hrs u...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50459992(CHEMBL4227180)
Affinity DataEC50:  0.00200nMAssay Description:Agonist activity at human GLP1 receptor expressed in HEK293 cells assessed as increase in cAMP level after 5 hrs by CRE driven luciferase reporter ge...More data for this Ligand-Target Pair
Ligand InfoKEGGPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataEC50:  0.00200nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50121402(CHEMBL3616772)
Affinity DataEC50:  0.00200nMAssay Description:Agonist activity at human GLP1 receptor expressed in BHK cells after 3 hrs by CRE firefly luciferase reporter gene assay in absence of human serum al...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM537032(US11897851, Compound 138a)
Affinity DataEC50:  0.00200nMAssay Description:To optimize functional activity directed toward Gas coupling, a HEK293/CRE-Luc cell line developed by HDB stably expressing the GLP-1 Receptor was us...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50495419(CHEMBL3110312)
Affinity DataEC50:  0.00200nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273767(CHEMBL503693)
Affinity DataEC50:  0.00209nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275545(CHEMBL4126953)
Affinity DataEC50:  0.00220nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50266687(CHEMBL4072029)
Affinity DataEC50:  0.00220nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275594(CHEMBL4130225)
Affinity DataEC50:  0.00220nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275595(CHEMBL4127525)
Affinity DataEC50:  0.00250nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataEC50:  0.00282nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataEC50:  0.00288nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50459984(CHEMBL4225795)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1 receptor expressed in HEK293 cells assessed as increase in cAMP level after 5 hrs by CRE driven luciferase reporter ge...More data for this Ligand-Target Pair
Ligand InfoKEGGPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50459993(CHEMBL4229251)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1 receptor expressed in HEK293 cells assessed as increase in cAMP level after 5 hrs by CRE driven luciferase reporter ge...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50495409(CHEMBL3110313)
Affinity DataEC50:  0.00300nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50152769(CHEMBL410972 | GLP-1(7-36)-NH2 | GLP-17-(7-36) der...)
Affinity DataEC50:  0.00300nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50495416(CHEMBL3110319)
Affinity DataEC50:  0.00300nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50495417(CHEMBL3110318)
Affinity DataEC50:  0.00300nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50121536(CHEMBL3616717)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1 receptor expressed in BHK cells after 3 hrs by CRE firefly luciferase reporter gene assay in absence of human serum al...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM537033(US11897851, Compound 138)
Affinity DataEC50:  0.00300nMAssay Description:To optimize functional activity directed toward Gas coupling, a HEK293/CRE-Luc cell line developed by HDB stably expressing the GLP-1 Receptor was us...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM570323(US11897851, Compound 214)
Affinity DataEC50:  0.00300nMAssay Description:To optimize functional activity directed toward Gas coupling, a HEK293/CRE-Luc cell line developed by HDB stably expressing the GLP-1 Receptor was us...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50261508(CHEMBL525934 | [Gly8,Glu22]GLP-1(7,37)-NH2)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50121405(CHEMBL3616767)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1 receptor expressed in BHK cells after 3 hrs by CRE firefly luciferase reporter gene assay in absence of human serum al...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50120380(CHEMBL3616743)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1 receptor expressed in BHK cells after 3 hrs by CRE firefly luciferase reporter gene assay in absence of human serum al...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50495422(CHEMBL3110306)
Affinity DataEC50:  0.00300nMAssay Description:Activation of human GLP-1 receptor overexpressed in HEK293 cells assessed as cAMP accumulation after 20 mins by HTRF assayMore data for this Ligand-Target Pair
Ligand InfoKEGGPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273771(CHEMBL526164)
Affinity DataEC50:  0.00331nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataEC50:  0.00360nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataEC50:  0.00380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50275564(CHEMBL4128125)
Affinity DataEC50:  0.00390nMAssay Description:Agonist activity at human GLP1R expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50266691(CHEMBL4086979)
Affinity DataEC50:  0.00390nMAssay Description:Agonist activity at human GLP-1 receptor expressed in HEK293 cells assessed as cAMP accumulation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Schrodinger

Curated by ChEMBL
LigandPNGBDBM50595602(CHEMBL5174431)
Affinity DataEC50:  0.00398nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells coexpressing beta-arrestin-2 assessed as reduction in cAMP accumulation incubated for 2 hrs u...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Displayed 1 to 50 (of 2542 total ) | Next | Last >>
Jump to: